POLR1B Antibody

Name POLR1B Antibody
Supplier Novus Biologicals
Catalog NBP1-53191
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POLR1B (polymerase (RNA) I polypeptide B, 128kDa) The peptide sequence was selected from the middle region of POLR1B)(50ug). Peptide sequence SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POLR1B
Conjugate Unconjugated
Supplier Page Shop

Product images