Name | POLR1B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-53191 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to POLR1B (polymerase (RNA) I polypeptide B, 128kDa) The peptide sequence was selected from the middle region of POLR1B)(50ug). Peptide sequence SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | POLR1B |
Conjugate | Unconjugated |
Supplier Page | Shop |