POLR3B Antibody

Name POLR3B Antibody
Supplier Novus Biologicals
Catalog NBP1-54363
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POLR3B(polymerase (RNA) III (DNA directed) polypeptide B) The peptide sequence was selected from the C terminal of POLR3B. Peptide sequence IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POLR3B
Conjugate Unconjugated
Supplier Page Shop

Product images