PEX5 Antibody

Name PEX5 Antibody
Supplier Novus Biologicals
Catalog NBP1-54585
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PEX5(peroxisomal biogenesis factor 5) The peptide sequence was selected from the N terminal of PEX5. Peptide sequence TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PEX5
Conjugate Unconjugated
Supplier Page Shop

Product images