ACAT Antibody
| Name | ACAT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80547 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig |
| Antigen | Synthetic peptide directed towards the middle region of human SOAT1 (NP_003092). Peptide sequence ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SOAT1 |
| Supplier Page | Shop |
Product images
![Western Blot: ACAT Antibody [NBP1-80547] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8376_ACAT-Antibody-Western-Blot-NBP1-80547-img0003.jpg)
Western Blot: ACAT Antibody [NBP1-80547] - Hela cell lysate, concentration 0.2-1 ug/ml.