CLIC2 Antibody

Name CLIC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-80058
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Bovine, Dog, Rabbit
Antigen Synthetic peptide directed towards the C terminal of human CLIC2. Peptide sequence SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene CLIC2
Supplier Page Shop

Product images