Name | CLIC2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80058 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Bovine, Dog, Rabbit |
Antigen | Synthetic peptide directed towards the C terminal of human CLIC2. Peptide sequence SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | CLIC2 |
Supplier Page | Shop |