ACD Antibody

Name ACD Antibody
Supplier Novus Biologicals
Catalog NBP1-80212
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the c terminal of mouse Acd. Peptide sequence PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Acd
Conjugate Unconjugated
Supplier Page Shop

Product images