RNase H1 Antibody

Name RNase H1 Antibody
Supplier Novus Biologicals
Catalog NBP1-80448
Prices $329.00
Sizes 50 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human RNASEH1. Peptide sequence EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNASEH1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.