Proprotein Convertase 2/PCSK2 Antibody

Name Proprotein Convertase 2/PCSK2 Antibody
Supplier Novus Biologicals
Catalog NBP1-69146
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCSK2
Conjugate Unconjugated
Supplier Page Shop

Product images