CLCN5 Antibody

Name CLCN5 Antibody
Supplier Novus Biologicals
Catalog NBP1-69123
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen Synthetic peptides corresponding to Clcn5 (chloride channel 5) The peptide sequence was selected from the middle region of Clcn5. Peptide sequence LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLCN5
Conjugate Unconjugated
Supplier Page Shop

Product images