FLJ10808 Antibody

Name FLJ10808 Antibody
Supplier Novus Biologicals
Catalog NBP1-69106
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UBA6 (ubiquitin-like modifier activating enzyme 6) The peptide sequence was selected from the middle region of UBA6. Peptide sequence EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UBA6
Conjugate Unconjugated
Supplier Page Shop

Product images