ABCA7 Antibody

Name ABCA7 Antibody
Supplier Novus Biologicals
Catalog NBP1-69064
Prices $349.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Guinea Pig
Antigen Synthetic peptides corresponding to Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7) The peptide sequence was selected from the middle region of Abca7. Peptide sequence DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene Abca7
Supplier Page Shop

Product images