ECE-2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69061
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Rat
• Antigen: Synthetic peptides corresponding to Ece2 (endothelin-converting enzyme 2) The peptide sequence was selected from the middle region of Ece2. Peptide sequence YMVELGMLLGGQPTSTRAQMQQVLELEIQLATITVPQDQRRDEEKIYHKM.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ECE2
• Conjugate: Unconjugated