Name | CLNS1A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69004 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Antigen | Synthetic peptides corresponding to Clns1a (chloride channel, nucleotide-sensitive, 1A) The peptide sequence was selected from the C terminal of Clns1a. Peptide sequence ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CLNS1A |
Conjugate | Unconjugated |
Supplier Page | Shop |