CLNS1A Antibody

Name CLNS1A Antibody
Supplier Novus Biologicals
Catalog NBP1-69004
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to Clns1a (chloride channel, nucleotide-sensitive, 1A) The peptide sequence was selected from the C terminal of Clns1a. Peptide sequence ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLNS1A
Conjugate Unconjugated
Supplier Page Shop

Product images