CACNA2D4 Antibody

Name CACNA2D4 Antibody
Supplier Novus Biologicals
Catalog NBP1-68992
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQ
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CACNA2D4
Conjugate Unconjugated
Supplier Page Shop

Product images