PIGZ Antibody
| Name | PIGZ Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69251 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PIGZ(phosphatidylinositol glycan anchor biosynthesis, class Z) The peptide sequence was selected from the N terminal of PIGZ. Peptide sequence VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIGZ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PIGZ Antibody [NBP1-69251] - This Anti-PIGZ antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15076_PIGZ%2520Antibody-Western%2520Blot-NBP1-69251-img0001.jpg)
Western Blot: PIGZ Antibody [NBP1-69251] - This Anti-PIGZ antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.