PIGZ Antibody

Name PIGZ Antibody
Supplier Novus Biologicals
Catalog NBP1-69251
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIGZ(phosphatidylinositol glycan anchor biosynthesis, class Z) The peptide sequence was selected from the N terminal of PIGZ. Peptide sequence VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIGZ
Conjugate Unconjugated
Supplier Page Shop

Product images