P2Y1/P2RY1 Antibody
| Name | P2Y1/P2RY1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69246 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to P2RY12(purinergic receptor P2Y, G-protein coupled, 12) The peptide sequence was selected from the N terminal of P2RY12 (NP_795345). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | P2RY12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246]](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14650_P2Y1-P2RY1-Antibody-Western-Blot-NBP1-69246-img0002.jpg)
![Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14651_P2Y1-P2RY1%2520Antibody-Western%2520Blot-NBP1-69246-img0003.jpg)