GPR161 Antibody
| Name | GPR161 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69244 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GPR161(G protein-coupled receptor 161) The peptide sequence was selected from the N terminal of GPR161. Peptide sequence MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GPR161 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GPR161 Antibody [NBP1-69244] - This Anti-GPR161 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24316_GPR161-Antibody-Western-Blot-NBP1-69244-img0001.jpg)
Western Blot: GPR161 Antibody [NBP1-69244] - This Anti-GPR161 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.
![Immunohistochemistry-Paraffin: GPR161 Antibody [NBP1-69244] - Human kidney, epithelial cells of renal tubule (indicated with arrows), stained with GPR161 Antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24317_GPR161-Antibody-Immunohistochemistry-Paraffin-NBP1-69244-img0002.jpg)
Immunohistochemistry-Paraffin: GPR161 Antibody [NBP1-69244] - Human kidney, epithelial cells of renal tubule (indicated with arrows), stained with GPR161 Antibody.