ARID5B Antibody

Name ARID5B Antibody
Supplier Novus Biologicals
Catalog NBP1-69169
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARID5B (AT rich interactive domain 5B (MRF1-like)) The peptide sequence was selected from the C terminal of ARID5B (NP_115575). Peptide sequence: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARID5B
Conjugate Unconjugated
Supplier Page Shop

Product images