Name | ARID5B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69169 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ARID5B (AT rich interactive domain 5B (MRF1-like)) The peptide sequence was selected from the C terminal of ARID5B (NP_115575). Peptide sequence: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ARID5B |
Conjugate | Unconjugated |
Supplier Page | Shop |