ELL2 Antibody

Name ELL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-69220
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Zebrafish
Antigen Synthetic peptides corresponding to ELL2 (elongation factor, RNA polymerase II, 2) The peptide sequence was selected from the C terminal of ELL2. Peptide sequence PGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ELL2
Supplier Page Shop

Product images