SLC39A5 Antibody
| Name | SLC39A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69293 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat, Pig, Bovine, Dog, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter), member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC39A5 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC39A5 Antibody [NBP1-69293] - This Anti-SLC39A5 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8624_SLC39A5%2520Antibody-Western%2520Blot-NBP1-69293-img0001.jpg)
Western Blot: SLC39A5 Antibody [NBP1-69293] - This Anti-SLC39A5 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.