Sodium-Calcium Exchanger Antibody

Name Sodium-Calcium Exchanger Antibody
Supplier Novus Biologicals
Catalog NBP1-69515
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Horse, Rabbit
Antigen Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger), member 3) The peptide sequence was selected from the N terminal of Sodium-Calcium Exchanger. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC8A3
Supplier Page Shop

Product images