XYLT2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69321
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to XYLT2(xylosyltransferase II) The peptide sequence was selected from the middle region of XYLT2. Peptide sequence PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: XYLT2
• Conjugate: Unconjugated