Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody
| Name | Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69318 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PAM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PAM Antibody [NBP1-69318] - This Anti-PAM antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24266_PAM%2520Antibody-Western%2520Blot-NBP1-69318-img0001.jpg)
Western Blot: PAM Antibody [NBP1-69318] - This Anti-PAM antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.