Name | SRD5A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69612 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SRD5A3(steroid 5 alpha-reductase 3) The peptide sequence was selected from the N terminal of SRD5A3. Peptide sequence GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SRD5A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |