ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody
| Name | ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69570 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ST3GAL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST3GAL2 Antibody [NBP1-69570] - This Anti-ST3GAL2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16541_ST3GAL2%2520Antibody-Western%2520Blot-NBP1-69570-img0001.jpg)
Western Blot: ST3GAL2 Antibody [NBP1-69570] - This Anti-ST3GAL2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.