UGT1A6 Antibody
| Name | UGT1A6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69707 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UGT1A6(UDP glucuronosyltransferase 1 family, polypeptide A6) The peptide sequence was selected from the C terminal of UGT1A6 (NP_001063). Peptide sequence APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UGT1A6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UGT1A6 Antibody [NBP1-69707] - This Anti-UGT1A6 antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24678_UGT1A6-Antibody-Western-Blot-NBP1-69707-img0001.jpg)
Western Blot: UGT1A6 Antibody [NBP1-69707] - This Anti-UGT1A6 antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.
![Immunohistochemistry: UGT1A6 Antibody [NBP1-69707] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Tim](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24679_UGT1A6%2520Antibody-Immunohistochemistry-NBP1-69707-img0002.jpg)
Immunohistochemistry: UGT1A6 Antibody [NBP1-69707] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Tim