IGSF8/CD316 Antibody

Name IGSF8/CD316 Antibody
Supplier Novus Biologicals
Catalog NBP1-68899
Prices $139.00
Sizes 20 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to IGSF8 (immunoglobulin superfamily, member 8) The peptide sequence was selected from the middle region of IGSF8. Peptide sequence LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene IGSF8
Conjugate Unconjugated
Supplier Page Shop

Product images