Name | IGSF8/CD316 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-68899 |
Prices | $139.00 |
Sizes | 20 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to IGSF8 (immunoglobulin superfamily, member 8) The peptide sequence was selected from the middle region of IGSF8. Peptide sequence LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | IGSF8 |
Conjugate | Unconjugated |
Supplier Page | Shop |