AP3B1 Antibody

Name AP3B1 Antibody
Supplier Novus Biologicals
Catalog NBP1-68927
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Rat
Antigen Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AP3B1
Conjugate Unconjugated
Supplier Page Shop

Product images