SLC22A7 Antibody
| Name | SLC22A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62660 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEER |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC22A7 Antibody [NBP1-62660] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14452_SLC22A7-Antibody-Western-Blot-NBP1-62660-img0004.jpg)
Western Blot: SLC22A7 Antibody [NBP1-62660] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
![Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14453_SLC22A7-Antibody-Immunohistochemistry-Paraffin-NBP1-62660-img0002.jpg)
Immunohistochemistry-Paraffin: SLC22A7 Antibody [NBP1-62660] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
![Western Blot: SLC22A7 Antibody [NBP1-62660] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14454_SLC22A7-Antibody-Western-Blot-NBP1-62660-img0003.jpg)
Western Blot: SLC22A7 Antibody [NBP1-62660] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.