CD77 Synthase Antibody

Name CD77 Synthase Antibody
Supplier Novus Biologicals
Catalog NBP1-62583
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene A4GALT
Conjugate Unconjugated
Supplier Page Shop

Product images