Name | CD77 Synthase Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62583 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to A4GALT(alpha 1,4-galactosyltransferase (globotriaosylceramide synthase)) The peptide sequence was selected from the middle region of A4GALT (NP_059132). Peptide sequence RIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAF |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | A4GALT |
Conjugate | Unconjugated |
Supplier Page | Shop |