PAOX Antibody
| Name | PAOX Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70666 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PAOX(polyamine oxidase (exo-N4-amino)) The peptide sequence was selected from the C terminal of PAOX. Peptide sequence LCLTQVLRRVTGNPRLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PAOX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PAOX Antibody [NBP1-70666] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7083_PAOX-Antibody-Western-Blot-NBP1-70666-img0002.jpg)
![Western Blot: PAOX Antibody [NBP1-70666] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7084_PAOX%2520Antibody-Western%2520Blot-NBP1-70666-img0003.jpg)