FTSJD1 Antibody

Name FTSJD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-70751
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FTSJD1 (FtsJ methyltransferase domain containing 1) The peptide sequence was selected from the middle region of FTSJD1. Peptide sequence LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CMTR2
Conjugate Unconjugated
Supplier Page Shop

Product images