COL8A2 Antibody

Name COL8A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79787
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the middle region of human COL8A2The immunogen for this antibody is COL8A2. Peptide sequence AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene COL8A2
Supplier Page Shop

Product images