ENOX2 Antibody

Name ENOX2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79778
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ENOX2The immunogen for this antibody is ENOX2. (YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE). Peptide sequence YRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ENOX2
Conjugate Unconjugated
Supplier Page Shop

Product images