Name | Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79949 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptide directed towards the N terminal of human CHRNA9The immunogen for this antibody is CHRNA9. Peptide sequence MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CHRNA9 |
Supplier Page | Shop |