FGD1 Antibody
| Name | FGD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79979 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human FGD1. Peptide sequence WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FGD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FGD1 Antibody [NBP1-79979] - Raji cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14577_FGD1-Antibody-Western-Blot-NBP1-79979-img0002.jpg)
![Immunohistochemistry: FGD1 Antibody [NBP1-79979] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14578_FGD1-Antibody-Immunohistochemistry-NBP1-79979-img0003.jpg)