Glutaminyl-peptide Cyclotransferase/QPCT Antibody
| Name | Glutaminyl-peptide Cyclotransferase/QPCT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79295 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human QPCTThe immunogen for this antibody is QPCT. Peptide sequence SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | QPCT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: QPCT Antibody [NBP1-79295] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16081_QPCT%2520Antibody-Western%2520Blot-NBP1-79295-img0002.jpg)
Western Blot: QPCT Antibody [NBP1-79295] - Human Muscle lysate, concentration 0.2-1 ug/ml.