Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody
| Name | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79294 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptide directed towards the middle region of human HS2ST1. Peptide sequence GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HS2ST1 |
| Supplier Page | Shop |
Product images
![Western Blot: Heparan sulfate 2-O-sulfotransferase 1 Antibody [NBP1-79294] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/8944_Heparan%2520sulfate%25202-O-sulfotransferase%25201%2520Antibody-Western%2520Blot-NBP1-79294-img0003.jpg)
Western Blot: Heparan sulfate 2-O-sulfotransferase 1 Antibody [NBP1-79294] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.