ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody

Name ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-79292
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptide directed towards the middle region of human ST8SIA4The immunogen for this antibody is ST8SIA4. Peptide sequence DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ST8SIA4
Supplier Page Shop

Product images