C1D Antibody

Name C1D Antibody
Supplier Novus Biologicals
Catalog NBP1-79373
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Zebrafish
Antigen Synthetic peptide directed towards the middle region of human C1DThe immunogen for this antibody is C1D. Peptide sequence LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene C1D
Supplier Page Shop

Product images