SERTAD2 Antibody

Name SERTAD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79455
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human SERTAD2. Peptide sequence: ISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPMFTPSSQP
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SERTAD2
Conjugate Unconjugated
Supplier Page Shop

Product images