| Name | NAGS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79444 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human NAGSThe immunogen for this antibody is NAGS. Peptide sequence YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NAGS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |