Polypeptide GalNac Transferase 3/GALNT3 Antibody
| Name | Polypeptide GalNac Transferase 3/GALNT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74244 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | Synthetic peptides corresponding to the N terminal of Galnt3. Immunizing peptide sequence PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GALNT3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Polypeptide GalNac Transferase 3/GALNT3 Antibody [NBP1-74244] - Titration: 1.0 ug/ml Positive Control: Rat Brain.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15253_Polypeptide-GalNac-Transferase-3-GALNT3-Antibody-Western-Blot-NBP1-74244-img0003.jpg)
Western Blot: Polypeptide GalNac Transferase 3/GALNT3 Antibody [NBP1-74244] - Titration: 1.0 ug/ml Positive Control: Rat Brain.