AGPAT3 Antibody

Name AGPAT3 Antibody
Supplier Novus Biologicals
Catalog NBP1-74276
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the middle region of AGPAT3 (NP_064517). Immunizing peptide sequence KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AGPAT3
Conjugate Unconjugated
Supplier Page Shop

Product images