alpha COP I Antibody

Name alpha COP I Antibody
Supplier Novus Biologicals
Catalog NBP1-59298
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COPA(coatomer protein complex, subunit alpha) The peptide sequence was selected from the middle region of COPA. Peptide sequence IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEIT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COPA
Conjugate Unconjugated
Supplier Page Shop

Product images