alpha COP I Antibody

Name alpha COP I Antibody
Supplier Novus Biologicals
Catalog NBP1-59297
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COPA(coatomer protein complex, subunit alpha) The peptide sequence was selected from the N terminal of COPA. Peptide sequence PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COPA
Conjugate Unconjugated
Supplier Page Shop

Product images