Neprilysin-2/MMEL1 Antibody

Name Neprilysin-2/MMEL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59349
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MMEL1(membrane metallo-endopeptidase-like 1) The peptide sequence was selected from the middle region of MMEL1. Peptide sequence EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MMEL1
Conjugate Unconjugated
Supplier Page Shop

Product images