Chondromodulin-1/LECT1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59348
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to LECT1(leukocyte cell derived chemotaxin 1) The peptide sequence was selected from the N terminal of LECT1. Peptide sequence AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: LECT1
• Conjugate: Unconjugated