DORFIN Antibody

Name DORFIN Antibody
Supplier Novus Biologicals
Catalog NBP1-59367
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to RNF19A(ring finger protein 19A) The peptide sequence was selected from the N terminal of RNF19A. Peptide sequence IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RNF19A
Supplier Page Shop

Product images