LRRC8A Antibody
| Name | LRRC8A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59493 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LRRC8A(leucine rich repeat containing 8 family, member A) The peptide sequence was selected from the N terminal of LRRC8A. Peptide sequence IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC8A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LRRC8A Antibody [NBP1-59493] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7317_LRRC8A-Antibody-Western-Blot-NBP1-59493-img0003.jpg)
![Western Blot: LRRC8A Antibody [NBP1-59493] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7318_LRRC8A-Antibody-Western-Blot-NBP1-59493-img0002.jpg)